PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g22730.1.p
Common NameBRADI_4g22730, LOC100835565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 288aa    MW: 31292 Da    PI: 10.3887
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g22730.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-172267147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg W + Ede+l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  Bradi4g22730.1.p 22 RGHWRPGEDEKLRQLVEKYGPQNWNSIAEKLE-GRSGKSCRLRWFNQ 67
                      899*****************************.***********996 PP

2Myb_DNA-binding61.51.7e-1975118247
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++T+eE+e+l+ a++ +G++ W++Iar+++ gRt++ +k++w+ +
  Bradi4g22730.1.p  75 RPFTEEEEERLLAAHRVHGNK-WALIARHFP-GRTDNAVKNHWHVV 118
                       69*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1321768IPR017930Myb domain
SuperFamilySSF466892.25E-3020115IPR009057Homeodomain-like
SMARTSM007172.1E-142170IPR001005SANT/Myb domain
PfamPF002499.0E-172267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-272375IPR009057Homeodomain-like
CDDcd001672.05E-142566No hitNo description
PROSITE profilePS5129428.45669123IPR017930Myb domain
SMARTSM007171.9E-1673121IPR001005SANT/Myb domain
PfamPF002492.3E-1674117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-2276118IPR009057Homeodomain-like
CDDcd001671.24E-885116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MASSSTTNTS DGGGVKPSSC PRGHWRPGED EKLRQLVEKY GPQNWNSIAE KLEGRSGKSC  60
RLRWFNQLDP RINKRPFTEE EEERLLAAHR VHGNKWALIA RHFPGRTDNA VKNHWHVVRA  120
RRSRERCRLL AKASASASSS TLIFPPYYNS YSSSQIDFSS FKPTATASGF FFGSSSQYSL  180
PVGPAAAATP LLFSASSAAA GVGKSLLVSP RYRSYDQREP AAMSIAFASP AASREALAMD  240
GSDHSRPRFR KEYYGRVEGS GGEPVKASGV GDKPPAFIDF LGVGVSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31221227107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576185.10.0PREDICTED: transcription factor MYB44
TrEMBLI1IMN80.0I1IMN8_BRADI; Uncharacterized protein
STRINGBRADI4G22730.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-56myb domain protein 52